Host taxon 10090
Protein NP_766095.1
SH3 domain-binding glutamic acid-rich-like protein 2
Mus musculus
Gene Sh3bgrl2, UniProt Q8BG73
>NP_766095.1|Pseudomona aeruginosa PA01|SH3 domain-binding glutamic acid-rich-like protein 2
MVVRVFVASCSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNIPPEKKPAQGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRPASTAEP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.88 | -0.883116696685571 | 0.00028 | 32071273 | |
Retrieved 1 of 1 entries in 10.3 ms
(Link to these results)