Host taxon 10090
Protein NP_036139.3
SH2 domain-containing protein 1B
Mus musculus
Gene Sh2d1b1, UniProt Q149T1
>NP_036139.3|Pseudomona aeruginosa PA01|SH2 domain-containing protein 1B
MDLPYYHGCLTKRECEALLLKGGVDGNFLIRDSESVPGALCLCVSFKKLVYSYRIFREKHGYYRIETNAHTPRTIFPNLQELVSKYGKPGQGLVVHLSNPIMRNNLCQRGRRMELELNVYENTDKEYVDVLP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.27 | -2.26803397939362 | 0.0017 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)