Host taxon 10090
Protein NP_035444.1
serum amyloid A-2 protein preproprotein
Mus musculus
Gene Saa2, UniProt P05367
>NP_035444.1|Pseudomona aeruginosa PA01|serum amyloid A-2 protein preproprotein
MKLLTSLVFCSLLLGVCHGGFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMADQEANRHGRSGKDPNYYRPPGLPAKY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 7.25 | 7.246782499604 | 8.2e-7 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)