Host taxon 10090
Protein NP_001182414.1
serine/arginine-rich splicing factor 7 isoform 2
Mus musculus
Gene Srsf7, UniProt Q8BL97
>NP_001182414.1|Pseudomona aeruginosa PA01|serine/arginine-rich splicing factor 7 isoform 2
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSVSLRRSRSASLRRSRSGSIIGSRSRSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPHRSASPERMD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.74 | 0.735954707956716 | 3.5e-7 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)