Host taxon 10090
Protein NP_598815.2
serine palmitoyltransferase small subunit A
Mus musculus
Gene Sptssa, UniProt Q8R207
>NP_598815.2|Pseudomona aeruginosa PA01|serine palmitoyltransferase small subunit A
MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSVVGMALYTGYVFMPQHIMAILHYFEIVQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.63 | -0.633208620562211 | 0.019 | 32071273 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)