Bacterial taxon 208964
Protein WP_003112869.1
septal ring lytic transglycosylase RlpA family protein
Pseudomona aeruginosa PA01
Gene rlpA, UniProt Q9HVT6
>WP_003112869.1|Pseudomona aeruginosa PA01|septal ring lytic transglycosylase RlpA family protein
MPTPSAAARLALAVLPLFLAGCSSLAGSGSADTGEASYYGSRHAGLRTASGERYNPNAMTAAHRTLPFGARVRVTNLDNRRSVVVRINDRGPFRRGRIIDVSRKAAEGLGMIRSGVAPVRIESLD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ 1.24 | 1.23832470873969 | 1.7e-6 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)