Host taxon 10090
Protein NP_001165539.1
sentrin-specific protease 8 isoform a
Mus musculus
Gene Senp8, UniProt Q9D2Z4
>NP_001165539.1|Pseudomona aeruginosa PA01|sentrin-specific protease 8 isoform a
MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVCFISPEVTQFIKCTSSPAEIAMFLEPLDLPHKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSIHAKQVAEKLKAFLGSKGDKLVFVEEKAPAQENSYDCGMYVICNTEALCQSLFRRQPESPLQLLTPTYITKKRGEWKDLIARLAKKNEVATEECS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.3 | -2.30019186675529 | 0.00088 | 32071273 | |
Retrieved 1 of 3 entries in 1.3 ms
(Link to these results)