Host taxon 10090
Protein NP_444497.1
selenoprotein M precursor
Mus musculus
Gene Selenom, UniProt Q8VHC3
>NP_444497.1|Pseudomona aeruginosa PA01|selenoprotein M precursor
MSILLSPPSLLLLLAALVAPATSTTNYRPDWNRLRGLARGRVETCGGUQLNRLKEVKAFVTEDIQLYHNLVMKHLPGADPELVLLSRNYQELERIPLSQMTRDEINALVQELGFYRKSAPEAQVPPEYLWAPAKPPEEASEHDDL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.51 | -1.51000347926674 | 0.00056 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)