Host taxon 10090
Protein NP_064363.2
selenoprotein K
Mus musculus
Gene Selenok, UniProt Q9JLJ1
>NP_064363.2|Pseudomona aeruginosa PA01|selenoprotein K
MVYISNGQVLDSRNQSPWRVSFLTDFFWGIAEFVVFFFKTLLQQDVKKRRGYGSSSDSRYDDGRGPPGNPPRRMGRISHLRGPSPPPMAGGUGR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.7 | 0.695083912172919 | 0.0021 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)