Host taxon 10090
Protein NP_001288563.1
secretory carrier-associated membrane protein 5 isoform 1
Mus musculus
Gene Scamp5, UniProt Q9JKD3
>NP_001288563.1|Pseudomona aeruginosa PA01|secretory carrier-associated membrane protein 5 isoform 1
MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHLSLTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISFFGTNIGSAVVMLIPTVMFTVVAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.76 | -1.75704956697335 | 0.0001 | 32071273 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)