Host taxon 10090
Protein NP_081183.3
secreted and transmembrane protein 1b precursor
Mus musculus
Gene Sectm1b, UniProt Q9D966
>NP_081183.3|Pseudomona aeruginosa PA01|secreted and transmembrane protein 1b precursor
MLAYSVTSSGLFPRMLWALLLLAASLNAYNHVWDKPCCTEHEVSVNRGSRVVMACNISNNLRDVTIELVTSKKTSIIFNQTPPGNYSKDSWQLHIQGGQAQLVITDAQGKHSGEYWWKLRGFQAEFKNFNLIVNAADRQKTEDLPVTKVPDKPPTAVRTEVIIIIAIATTIIITGIGVFVWYKQFPVAPQIQMSVPCLIHGSPGIPYLTLPP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.2 | 5.19640620727552 | 1.5e-8 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)