Host taxon 10090
Protein NP_001185738.1
scm-like with four MBT domains protein 2 isoform 3
Mus musculus
Gene Sfmbt2, UniProt Q8BG70
>NP_001185738.1|Pseudomona aeruginosa PA01|scm-like with four MBT domains protein 2 isoform 3
MERYLPVSKKRNSSSSLEKITGSANGNGTLYSEEDTNLEENDFSWGDYLEETGTRAVPHVSFRHVEISIRSNFQPGMKLEVANKNNPDTYWVATIITTCGQLLLLRYCGYGEDRRADFWCDVIIADLHPVGWCTQNNKVLRPPDAIKDKYSDWTDFLIRELTGSRTAPANLLEGVCIAIIHLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.72 | 1.72224441518446 | 1.5e-7 | 32071273 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)