Host taxon 10090
Protein NP_035673.3
S-phase kinase-associated protein 1
Mus musculus
Gene Skp1a, UniProt Q5SUR3
>NP_035673.3|Pseudomona aeruginosa PA01|S-phase kinase-associated protein 1
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.37 | -0.365548075529994 | 0.0025 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)