Host taxon 10090
Protein NP_080804.1
RNA transcription, translation and transport factor protein
Mus musculus
Gene RTRAF, UniProt Q9CQE8
>NP_080804.1|Pseudomona aeruginosa PA01|RNA transcription, translation and transport factor protein
MFRRKLTALDYHNPSGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLKDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNRKNTDNAAKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALEKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.57 | -0.568181187825838 | 0.0033 | 32071273 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)