Bacterial taxon 208964
Protein WP_003097086.1
RNA polymerase-binding protein DksA
Pseudomona aeruginosa PA01
Gene dksA, UniProt Q9HT38
>WP_003097086.1|Pseudomona aeruginosa PA01|RNA polymerase-binding protein DksA
MTEQELLAQPDAAYMDEAQQDFFRDLLLRQRQELQARIEGEFGELRDLERPSDEADLASREEQRQWQLRLLEREKKLLDKIDEALERLARGDYGWCQETGEPIGLRRLLLRPTATLCIEAKERQEKRERHVRHN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ 1.85 | 1.85340194473433 | 6.0e-9 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)