Host taxon 10090
Protein NP_038904.1
RING finger protein 11
Mus musculus
Gene Rnf11, UniProt Q9QYK7
>NP_038904.1|Pseudomona aeruginosa PA01|RING finger protein 11
MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPIYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.72 | 0.721868081378576 | 3.9e-9 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)