Host taxon 10090
Protein NP_001258726.1
RING finger and CHY zinc finger domain-containing protein 1 isoform 2
Mus musculus
Gene Rchy1, UniProt Q9CR50
>NP_001258726.1|Pseudomona aeruginosa PA01|RING finger and CHY zinc finger domain-containing protein 1 isoform 2
MAATAREDGVRNLAQGPRGCEHYDRACLLKAQQTCEDCSTLFGEYYCSICHLFDKDKRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDTEVAQTPMPSEYQNVTVDILCNDCNGRSTVQFHILGMKCKLCDSYNTAQAGGRRVPVDQQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.91 | 0.913838755114544 | 1.1e-5 | 32071273 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)