Host taxon 10090
Protein NP_084535.1
RILP-like protein 2
Mus musculus
Gene Rilpl2, UniProt Q99LE1
>NP_084535.1|Pseudomona aeruginosa PA01|RILP-like protein 2
MEDHPVREEEDGEEDEGALAKSPLQLTTDDVYDISYVVGRELMALGSDPRVTRLQFKIVRVMEMLETLVNEGSLAVEELRMERDNLKQEVEGLRKAGVSGAQVNLGPDKMVVDLTDPNRPRFTLQELREVLQERNKLKSQLLLVQEELQCYRSGLLPPRETPGGRREKDAVVAMGNGEKEERTIMKKLFSFRSGKHT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.87 | 1.87148250452436 | 2.9e-16 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)