Host taxon 10090
Protein NP_067447.2
ribonuclease 4 precursor
Mus musculus
Gene Rnase4, UniProt Q8C7E4
>NP_067447.2|Pseudomona aeruginosa PA01|ribonuclease 4 precursor
MMDLQRTQSLLLLLVLTLLGLGLVQPSYGQDRMYQRFLRQHVDPQVTGGNDNYCNVMMQRRKMTSVQCKRFNTFIHEDIWNIRGICSTTNILCKNGQMNCHEGVVKVTDCRETGNSKAPNCRYRARTSTRRVVIACEGDPEVPVHFDR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.11 | -1.11040705811407 | 1.9e-33 | 32071273 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)