Host taxon 10090
Protein NP_001278788.1
rho-related GTP-binding protein RhoC precursor
Mus musculus
Gene Rhoc, UniProt Q62159
>NP_001278788.1|Pseudomona aeruginosa PA01|rho-related GTP-binding protein RhoC precursor
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.59 | 2.58634819836094 | 2.0e-185 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)