Host taxon 10090
Protein NP_001288230.1
rho GDP-dissociation inhibitor 2 isoform 1
Mus musculus
Gene Arhgdib, UniProt Q61599
>NP_001288230.1|Pseudomona aeruginosa PA01|rho GDP-dissociation inhibitor 2 isoform 1
MTEKDAQPQLEEADDDLDSKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDVPVVADPTVPNVTVTRLSLVCDSAPGPITMDLTGDLEALKKDTFVLKEGIEYRVKINFKVNKDIVSGLKYVQHTYRTGMRVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLTWEWNLAIKKDWTE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.43 | 1.4276034167551 | 1.9e-23 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)