Host taxon 10090
Protein NP_077188.1
reticulon-4 isoform C
Mus musculus
Gene Rtn4, UniProt Q99P72
>NP_077188.1|Pseudomona aeruginosa PA01|reticulon-4 isoform C
MDDQKKRWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQAKIPGLKRKAE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.47 | 0.470429632371117 | 1.5e-10 | 32071273 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)