Host taxon 10090
Protein NP_065255.3
resistin-like alpha precursor
Mus musculus
Gene Retnla, UniProt Q9EP95
>NP_065255.3|Pseudomona aeruginosa PA01|resistin-like alpha precursor
MKTTTCSLLICISLLQLMVPVNTDETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.31 | -2.31099477279363 | 1.8e-30 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)