Host taxon 10090
Protein NP_035414.3
replication protein A 32 kDa subunit
Mus musculus
Gene Rpa2, UniProt Q3TE40
>NP_035414.3|Pseudomona aeruginosa PA01|replication protein A 32 kDa subunit
MWNSGFESFSSSTYGGAGGYTQSPGGFGSPTPSQAEKKSRVRAQHIVPCTISQLLSATLTDEVFRIGDVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAPPMDVRQWVDTDDASGENAVVPPETYVKVAGHLRSFQNKKSLVAFKIIPLEDMNEFTAHILEVVNSHMMLSKPNSQASAGRPSMSNPGMSEPGNFSGNNFMPANGLTVVQNQVLNLIKACPRPEGLNFQDLRSQLQHMPVPSIKQAVDFLCNEGHIYSTVDDDHFKSTDAE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.89 | 0.894378069012353 | 0.0056 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)