Host taxon 10090
Protein NP_080908.1
replication protein A 14 kDa subunit
Mus musculus
Gene Rpa3, UniProt Q9CQ71
>NP_080908.1|Pseudomona aeruginosa PA01|replication protein A 14 kDa subunit
MEDIMQLPKARVNASMLPQYIDRPVCFVGKLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGKVTAKATVLCASYTLFKEDTNRFDLELYNEAVKIINELPQFFPVGLPQHE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.11 | -2.10862031362579 | 0.049 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)