Host taxon 10090
Protein NP_033088.2
regulator of G-protein signaling 4
Mus musculus
Gene Rgs4, UniProt O08899
>NP_033088.2|Pseudomona aeruginosa PA01|regulator of G-protein signaling 4
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHSSSHSKKDKVVTCQRVSQEEVKKWAESLENLIHHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLQPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLTNPSSCGAEKQKGAKSSADCTSLVSQCA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.72 | 1.72301476019469 | 6.2e-36 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)