Host taxon 10090
Protein NP_079703.2
regulator of cell cycle RGCC
Mus musculus
Gene Rgcc, UniProt Q9DBX1
>NP_079703.2|Pseudomona aeruginosa PA01|regulator of cell cycle RGCC
MKPPSAQSSPAAVAAAAPAMDSAAAADLTDVLCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSVYRDSFTFSDEKLNSPTNSSPALLPSAVTPRKAKLGDTKELEDFIADLDRTLASM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.56 | 2.55762197897336 | 1.7e-108 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)