Host taxon 10090
Protein NP_031900.3
receptor expression-enhancing protein 5
Mus musculus
Gene Reep5, UniProt Q9CQG4
>NP_031900.3|Pseudomona aeruginosa PA01|receptor expression-enhancing protein 5
MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWFPFYYMLKCGFLLWCMAPSPANGAEMLYRRIIRPIFLKHESQVDSVVKDVKDKAKETADAISKEVKKATVNLLGDEKKST
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.47 | -0.470670877720592 | 0.00013 | 32071273 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)