Host taxon 10090
Protein NP_062384.1
receptor activity-modifying protein 3 precursor
Mus musculus
Gene Ramp3, UniProt Q9WUP1
>NP_062384.1|Pseudomona aeruginosa PA01|receptor activity-modifying protein 3 precursor
MKTPAQRLHLLPLLLLLCGECAQVCGCNETGMLERLPRCGKAFADMMQKVAVWKWCNLSEFIVYYESFTNCTEMETNIMGCYWPNPLAQSFITGIHRQFFSNCTVDRTHWEDPPDEVLIPLIAVPVVLTVAMAGLVVWRSKHTDRLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.18 | 2.18449537152953 | 4.4e-6 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)