Host taxon 10090
Protein NP_058590.1
receptor activity-modifying protein 1 isoform 1 precursor
Mus musculus
Gene Ramp1, UniProt Q9WTJ5
>NP_058590.1|Pseudomona aeruginosa PA01|receptor activity-modifying protein 1 isoform 1 precursor
MAPGLRGLPRCGLWLLLAHHLFMVTACRDPDYGTLIQELCLSRFKENMETIGKTLWCDWGKTIQSYGELTYCTKHVAHTIGCFWPNPEVDRFFIAVHHRYFSKCPISGRALRDPPNSILCPFIALPITVTLLMTALVVWRSKRTEGIV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.94 | -0.94094475471289 | 0.0096 | 32071273 | |
Retrieved 1 of 4 entries in 0.7 ms
(Link to these results)