Host taxon 10090
Protein NP_598446.2
ras-related protein Rab-31
Mus musculus
Gene Rab31, UniProt Q921E2
>NP_598446.2|Pseudomona aeruginosa PA01|ras-related protein Rab-31
MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLGPQENGNSGGIKLGNQSLQASRRCC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.37 | 1.36941173256037 | 4.8e-57 | 32071273 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)