Host taxon 10090
Protein NP_001334334.1
ras-related protein Rab-15 isoform 2
Mus musculus
Gene Rab15, UniProt D3YTZ8
>NP_001334334.1|Pseudomona aeruginosa PA01|ras-related protein Rab-15 isoform 2
MKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQKRQVGREQGQQLAKEYGMDFYETSACTNLNIKESFTRLTELVLQAHRKELDGLRTRASNELALAELEEDEGKPEGPANSSKTCWC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.76 | -0.759453229232276 | 0.00016 | 32071273 | |
Retrieved 1 of 3 entries in 1.4 ms
(Link to these results)