Host taxon 10090
Protein NP_835146.3
ras association domain-containing protein 4
Mus musculus
Gene Rassf4, UniProt Q8CB96
>NP_835146.3|Pseudomona aeruginosa PA01|ras association domain-containing protein 4
MKEACSSSSHVPVSDSKYILKSELLSLLKTYNCYHEGRSFQLRHREEEGTLIIEGLLNIAWGLRRPIRLQMQDDRERVHLPSATWVPERLSYLQKEASPQDSKVPTEEPGTQPANKAEVSGDSSGALEGEEEEVPQLMRTKSDASCIIQRRSKSRAPSEAQKIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRVNSTMTTQQVLTLLLNKFRVEDGPSEFALYTVHESGEQTKLKDCEYPLISRILHGPCEKIVKIFLMEADLSEEVPHDVAQYIKFEMPVLDSFVEKLKEEEEREIIKLTMKFQALRLTMLQRLEQLVEAK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.9 | -0.897058854103803 | 8.3e-9 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)