Host taxon 10090
Protein NP_001032833.1
putative mitochondrial import inner membrane translocase subunit Tim8 A-B
Mus musculus
Gene Timm8a2, UniProt Q4FZG7
>NP_001032833.1|Pseudomona aeruginosa PA01|putative mitochondrial import inner membrane translocase subunit Tim8 A-B
MESAWSSRGTSLGSSDPQLQRFMEAEVQKQRVQLLIHHMTELCWEKCMDKPGPRLDGRAELCLVNCVERFIDTSQFILNRLEQTQKARPLFSERLSD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 4.85 | 4.8494590273822 | 0.048 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)