Host taxon 10090
Protein NP_079833.1
Purkinje cell protein 4-like protein 1
Mus musculus
Gene Pcp4l1, UniProt Q6W8Q3
>NP_079833.1|Pseudomona aeruginosa PA01|Purkinje cell protein 4-like protein 1
MSELNTKTPPAANQASDPEEKGKPGSIKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDSSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.34 | -1.3396970662152 | 3.3e-8 | 32071273 | |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)