Host taxon 10090
Protein NP_082726.2
PTB domain-containing engulfment adapter protein 1
Mus musculus
Gene Gulp1, UniProt Q8K2A1
>NP_082726.2|Pseudomona aeruginosa PA01|PTB domain-containing engulfment adapter protein 1
MNRAFSRKKDKTWMHTPEALSKHYIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCFVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGMQKRIQDLETENMELKNKVQDLESRLRTTQVSTSPAHGVTVMSPSTDIFDMIPFSPISHQSPTSARNGTQLPPIPSRSAETKRDLFGAEPFDPFNCGSGDFPPDIQSKLDEMQEGFKMGLTLEGTVFCLDPLDSRC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.64 | -1.63678409331783 | 2.0e-5 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)