Host taxon 10090
Protein NP_079623.1
protein yippee-like 3 isoform a
Mus musculus
Gene Ypel3, UniProt P61237
>NP_079623.1|Pseudomona aeruginosa PA01|protein yippee-like 3 isoform a
MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.75 | -1.75369673155656 | 3.6e-13 | 32071273 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)