Host taxon 10090
Protein NP_001159860.1
protein tyrosine phosphatase type IVA 3 isoform 1
Mus musculus
Gene Ptp4a3, UniProt Q9D658
>NP_001159860.1|Pseudomona aeruginosa PA01|protein tyrosine phosphatase type IVA 3 isoform 1
MARMNRPAPVEVSYRHMRFLITHNPSNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLLKAKFYNDPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.84 | -0.838186736010247 | 7.6e-8 | 32071273 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)