Host taxon 10090
Protein NP_077133.1
protein transport protein Sec61 subunit beta
Mus musculus
Gene Sec61b, UniProt Q9CQS8
>NP_077133.1|Pseudomona aeruginosa PA01|protein transport protein Sec61 subunit beta
MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIAAVFMLHIWGKYTRS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.94 | -0.943929451762666 | 0.01 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)