Host taxon 10090
Protein NP_001074696.1
protein stum homolog
Mus musculus
Gene Stum, UniProt Q0VBF8
>NP_001074696.1|Pseudomona aeruginosa PA01|protein stum homolog
MEPLHKDAETAAAAAAVAAADPRGASSSSGVVVQVREKKGPLRAAIPYMPFPVAVICLFLNTFVPGLGTFVSAFTVLCGARTDLPDRHVCCVFWLNIAAALIQVLTAIVMVGWIMSIFWGMDMVILAISQGYKDQGIPQQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.29 | 1.28953637698949 | 0.0015 | 32071273 | |
Retrieved 1 of 3 entries in 1.1 ms
(Link to these results)