Host taxon 10090
Protein NP_033919.1
protein S100-G
Mus musculus
Gene S100g, UniProt P97816
>NP_033919.1|Pseudomona aeruginosa PA01|protein S100-G
MCAEKSPAEMKSIFQKYAAKEGDPDQLSKEELKLLIQSEFPSLLKASSTLDNLFKELDKNGDGEVSYEEFEAFFKKLSQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.09 | -1.08935989064729 | 0.00049 | 32071273 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)