Host taxon 10090
Protein NP_035443.1
protein S100-A6
Mus musculus
Gene S100a6, UniProt P14069
>NP_035443.1|Pseudomona aeruginosa PA01|protein S100-A6
MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.75 | 0.746437812100142 | 1.9e-14 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)