Host taxon 10090
Protein NP_058020.1
protein S100-A11
Mus musculus
Gene S100a11, UniProt P50543
>NP_058020.1|Pseudomona aeruginosa PA01|protein S100-A11
MPTETERCIESLIAVFQKYSGKDGNNTQLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNCDGQLDFQEFLNLIGGLAIACHDSFIQTSQKRI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.38 | 1.38469170838825 | 7.0e-20 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)