Host taxon 10090
Protein NP_033138.1
protein S100-A10
Mus musculus
Gene S100a10, UniProt P08207
>NP_033138.1|Pseudomona aeruginosa PA01|protein S100-A10
MPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.78 | 0.778265425889584 | 1.7e-10 | 32071273 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)