Host taxon 10090
Protein NP_035439.1
protein S100-A1
Mus musculus
Gene S100a1, UniProt P56565
>NP_035439.1|Pseudomona aeruginosa PA01|protein S100-A1
MGSELESAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSGFLDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.2 | -1.20189735030666 | 1.2e-9 | 32071273 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)