Host taxon 10090
Protein NP_080671.1
protein RER1
Mus musculus
Gene Rer1, UniProt Q9CQU3
>NP_080671.1|Pseudomona aeruginosa PA01|protein RER1
MSEGDSVGDSVHGKPSVVYRFFSRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMICTFFEAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHGKRRYKGKEDVGKTFAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.9 | -0.898000284341291 | 2.3e-6 | 32071273 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)