Host taxon 10090
Protein NP_001300899.1
protein phosphatase 1 regulatory subunit 1B isoform 2
Mus musculus
Gene Ppp1r1b, UniProt Q60829
>NP_001300899.1|Pseudomona aeruginosa PA01|protein phosphatase 1 regulatory subunit 1B isoform 2
MLFRVSEHSSPEEEASPHQRTSGEGHHPKSKRPNPCAYTPPSLKAVQHLQTISNLSENQASEEEDELGELRELGYPQEDDEEDEDEEEDEEEDSQAEVLKGSRGTVGQKPTCGRGLEGPWERPPPLDEPQRDGNSEDQVEGRATLSEPGEEPQHPSPP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.58 | -1.58433553180154 | 0.0019 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)