Host taxon 10090
Protein NP_597844.1
protein phosphatase 1 regulatory subunit 14C
Mus musculus
Gene Ppp1r14c, UniProt Q8R4S0
>NP_597844.1|Pseudomona aeruginosa PA01|protein phosphatase 1 regulatory subunit 14C
MSVVTGGGEAAGGGGGGGARVFFQSPRGGTGGSPGSSSSSGSSREDSAPVTTVAAAGQVQQQQRRHQQGKVTVKYDRKELRKRLVLEEWIVEQLGQLYGCEEEEMPDVEIDIDDLLDANSEEERASKLQEALVDCYKPTEEFIRELLSRIRGMRKLSPPQKKSV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.88 | -1.87877794679048 | 1.9e-19 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)