Host taxon 10090
Protein NP_705785.1
protein PAXX
Mus musculus
Gene Paxx, UniProt Q8K0Y7
>NP_705785.1|Pseudomona aeruginosa PA01|protein PAXX
MAPPLLSLPLCILPPGSGSPRLVCYCERDSGGDGDRDDFNLYVTDAAELWSTCFSPDSLARLKARFGLSGAEDIHSRFRAACQQQAVTVSLQEDRALITLSGDTPALAFDLSKVPSPEAAPRLQALTLSLAEHVCNLERRLAAAEETITSPKKNTQPAGTQFLPELDHQRGSSGPGVRRRCPGESLINPGFKSKKPAAGVDFDET
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.95 | -0.952049506371772 | 0.0087 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)