Host taxon 10090
Protein NP_079570.1
protein NATD1
Mus musculus
Gene Natd1, UniProt Q9DBW3
>NP_079570.1|Pseudomona aeruginosa PA01|protein NATD1
MAHATPPSALEQGGPIRVEHDRQRRQFSVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDAYRGRGIAKHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.24 | -1.24019269007408 | 1.8e-6 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)